General Information

  • ID:  hor000666
  • Uniprot ID:  Q9MYV1(83-119)
  • Protein name:  Calcitonin gene-related peptide 1
  • Gene name:  CALCA
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSEAF
  • Length:  37(83-119)
  • Propeptide:  MGLWKSSPFLAFSILVLCQAGGLQAAPFRSALEGLPDPTALSEKEGRLLLAALVKAYVQRKNELEQEQEQETEGSSITAQKRSCNTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSEAFGRRRRDLRA
  • Signal peptide:  MGLWKSSPFLAFSILVLCQAGGLQA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. It also elevates platelet cAMP
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q9MYV1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000666_AF2.pdbhor000666_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 445060 Formula: C162H264N50O52S2
Absent amino acids: DIMQWY Common amino acids: V
pI: 8.83 Basic residues: 4
Polar residues: 18 Hydrophobic residues: 13
Hydrophobicity: 15.14 Boman Index: -4463
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.92
Instability Index: 3154.32 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  1758974
  • Title:  Elucidation of the sequence of canine (pro)-calcitonin. A molecular biological and protein chemical approach.